SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008107 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008107
Domain Number 1 Region: 113-267
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000063
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008107   Gene: ENSCSAVG00000004823   Transcript: ENSCSAVT00000008215
Sequence length 270
Comment pep:novel reftig:CSAV2.0:reftig_3:1236680:1240902:1 gene:ENSCSAVG00000004823 transcript:ENSCSAVT00000008215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSVLDLKASGKVLLGRLMNMSTSLTDLLGEDHHKDIAVQKHFLQYSQVPFFQYKKYVM
DTTAHQTIDAEKLSATCWALCRHRYLNNPLVDNLDSVVPNELADALYWLFCIFTKISEPD
TYPPSIDYEEAELLLRKLCASLGIQWQQSHDQDSINGDAGYENANDEYEPMPPLQVTFQQ
LLSVISDMIGTEVARSHAFYRSMQWLCLTEYSDIMKTGWLYSRKPGTDTWKKRWAILRGT
KLSLYVTMLGQYMKEQIYLTGNMHVESLPG
Download sequence
Identical sequences H2YRZ7
ENSCSAVP00000008107 51511.ENSCSAVP00000008107 ENSCSAVP00000008107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]