SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000010189 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000010189
Domain Number 1 Region: 107-221
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000353
Family Second domain of FERM 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000010189   Gene: ENSCSAVG00000006014   Transcript: ENSCSAVT00000010313
Sequence length 333
Comment pep:novel reftig:CSAV2.0:reftig_37:1886724:1894805:-1 gene:ENSCSAVG00000006014 transcript:ENSCSAVT00000010313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVVVYLPDNTGHQFMIPNGKQTITSQYLQLIIASLKLPDALAKKCFALWLKSPLLDVQL
KPQHVPFRMVKQWPMLVEKFSMASDADKAQDEPALLFRRNAFLTKEDEMLITDTAVLNLL
KMEAKYNIQRGIYPCDFEDVEQLGTLLCINSEDKKKEMPGIVKENLQTLVPDHMARVKRS
FLSRQNSIEEKVLKSVRKVAKDETINPTIEFMKICWQLPYYGSVIFDGLVERAQSNPITS
LFATHTSLPVKVAISTSGVWVIDQEKKHVLIGLLYDEFNWEMAQPQQSDEEDSIASLFLE
FDDPKSGANEMLQIMSKEAPMMNSMIETCILMI
Download sequence
Identical sequences H2YXX8
ENSCSAVP00000010189 51511.ENSCSAVP00000010189 ENSCSAVP00000010189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]