SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000011273 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000011273
Domain Number 1 Region: 255-386
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-40
Family Third domain of FERM 0.0000012
Further Details:      
 
Domain Number 2 Region: 146-254
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-32
Family Second domain of FERM 0.00000282
Further Details:      
 
Domain Number 3 Region: 547-632
Classification Level Classification E-value
Superfamily Moesin tail domain 4.71e-27
Family Moesin tail domain 0.0001
Further Details:      
 
Domain Number 4 Region: 23-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-18
Family First domain of FERM 0.000066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000011273   Gene: ENSCSAVG00000006596   Transcript: ENSCSAVT00000011405
Sequence length 632
Comment pep:known reftig:CSAV2.0:reftig_54:734337:743979:1 gene:ENSCSAVG00000006596 transcript:ENSCSAVT00000011405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFRLKMSTIPLPQLKHHFCSNLQINVRVTTMDAELEFAIQPNTSGKQLFDQVVKTIGLRE
VWFFGLQYIDTKGYTTWLKLNKKVKFYLLPLLYILDITNVNTGSKCRQSPPKTVSRSMIF
QVTQQDIKKASPVLFKFRAKFHPEDVAEELIQEITQRLFFIQVKDGILSDEVYCPPETSV
LLASYAVQAKYGTYNADRHKGYLANDRLLPQRLYEQHKMTKEQWEERIQTWHCEHGVMNR
EDAMIEYLKIAQDLEMYGVNYFEIQNKKRTKLLLGVDALGLNIYESSDKLTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYVDRLRINKRILALCMGNHELYMRRRKPDTIEVQQ
MKAQAREEKNRKEQDRDQETIQQMAKEKEAALAKSLYYEEQLEKFRIDNERTQAELREKQ
AIAQKLAEDKERAEQERKELEELRRQAEEEAKALQQQKSATDMEKAAMEEDIQLKLREIE
DLRIAEQEKERENLEWKKRVYEEIRLKEVEIAELSQRQIVESIVVPEQVEHQENATSSSE
DDLQGKEFEHEEMERDRDEENRKTESEKNKALQDQLKELQKQLSHLRDQNVNSTQMDILH
NENVKAGRDKYKTLKQIRSGNTKHRIDEFECL
Download sequence
Identical sequences H2Z111
51511.ENSCSAVP00000011273 ENSCSAVP00000011273 ENSCSAVP00000011273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]