SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000011965 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000011965
Domain Number 1 Region: 23-131
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000942
Family Second domain of FERM 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000011965
Domain Number - Region: 136-225
Classification Level Classification E-value
Superfamily PH domain-like 0.0984
Family Third domain of FERM 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000011965   Gene: ENSCSAVG00000007033   Transcript: ENSCSAVT00000012104
Sequence length 230
Comment pep:novel reftig:CSAV2.0:reftig_60:909488:914023:1 gene:ENSCSAVG00000007033 transcript:ENSCSAVT00000012104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYRKTGFFIMIQRVVWACPITYENSMLTTFFFNQVLDDYLGGKFSYGEDTSRRFSKFHI
DEIVKLAAFLFVGHGNNHFPSQNDMETIIPRPALQHFKASVWCDKVCAHMKTTHSSNTPQ
AQCEFLSKIRKKKLFGSSFFHVDVKLGNRAQQPAIVAINASSFYLIDPDDDRIFMEQNVS
RIMSIEAMDNERNTCHVKISSATGDPKIVTIKSKKAQLIEGIVEHHLRCR
Download sequence
Identical sequences H2Z303
51511.ENSCSAVP00000011965 ENSCSAVP00000011965 ENSCSAVP00000011965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]