SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000014928 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000014928
Domain Number 1 Region: 389-514
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-17
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000014928   Gene: ENSCSAVG00000008741   Transcript: ENSCSAVT00000015102
Sequence length 529
Comment pep:known reftig:CSAV2.0:reftig_9:578947:590543:-1 gene:ENSCSAVG00000008741 transcript:ENSCSAVT00000015102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDDLFDGVEFEESRSPSPFAPTLTRQKSKLEIKCELSVRKQTCNEAEDTHMVTRQPSRR
PLARSTSSESVVSLGAEKKATPFPISIDSYRTEKRKSLRKQSDNKKVVRNESVQSVAPPR
AATVKEKIGGMMEEIQQQQRVIQQASAALNCCYDAHHGKGSITELEAEKLLLIASEKRLA
LLAEVQALKSRSVTEPPQTVQPCLGNLTIRNLRLPLRTEYIFSMASKKDCGDIRSHYYFL
LVRCGPTRILASHLASTHDSLSGDSLVFSDEFKLVDLESNFDITIEVYSVTHRSRADGVP
NQEKSKRKLSGILHKSLTPRKLRSRSHMTMTHTSSPGGPNAIRISSFSLIGAVSINLNDV
KSEKFTLQKVPFLSPISGHFACKIEADFQSNVEQRGFLTMFDDVGGLGAWHRRWCALIRG
VLFSWTYPDDEKYKEALCKIDLTSCISERIRTVERIMCARPNTFELRTMRPRRHGDKDNL
ITQDTGSVITTKHWLAADTKDERIAWIESMNQALADVRAWDTNALKPLK
Download sequence
Identical sequences H2ZBG3
ENSCSAVP00000014928 ENSCSAVP00000014928 51511.ENSCSAVP00000014928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]