SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016099 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016099
Domain Number 1 Region: 51-797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.93e-241
Family Motor proteins 0.000000000348
Further Details:      
 
Domain Number 2 Region: 1187-1291
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-20
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 1378-1477
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000301
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 4 Region: 1782-1838,1900-1936
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000054
Family Second domain of FERM 0.0092
Further Details:      
 
Domain Number 5 Region: 1306-1374
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000482
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 6 Region: 1148-1189
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000575
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000016099
Domain Number - Region: 1685-1753
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0243
Family Ras-binding domain, RBD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016099   Gene: ENSCSAVG00000009476   Transcript: ENSCSAVT00000016279
Sequence length 2033
Comment pep:novel reftig:CSAV2.0:reftig_1:1789449:1814180:-1 gene:ENSCSAVG00000009476 transcript:ENSCSAVT00000016279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTNVFVCVWQGSRVWLVNNGPDDLTPATVSVCDGVEVIYQTDYGEEQRMWMNELDSSKVK
PMNGLLLQGVEDMAKMTELNQASILCNLNTRYHQDEIYTYIGSILISVNPYKRLHELYDE
KTLARYTDKDLGAEPPHVYAISNECYSCMWKREENQCVLISGESGAGKTEATKFILKFIS
NISRRRSGKSEGENGRSIEKSILESGPILEALGNAKTVYNNNSSRFGKFIQLLISQAGQI
QGGRITDYLLEKHRVVRQNPGERNYHIFYQLIRGVKAEDRDRLFLMEPEEYHYLNQSGCC
SDPTLNDSEDWNMLEQALQVIGFKEGQKQDMMSVLSGILQLGNVAFVNAGGAQVVDTDVI
DRTSQLLGIDNERLEAVMKERTMKLRGENITSPQSIDQACDSRDSISMAVYSQLFRWIIK
INHRIKGHDDFHYIGVLDIFGFENFKTNRFEQFCINFANEKLQXXXXYDSHLMYSVSFRE
GIDWCDVEWADNSECLDLVEKNLGLMSLINEESRFPKGTDKSLLNKLHNQHAKNPFYVKP
RVTGSEFGIRHYAGEVMYNVNGFLEKNRDTFRDDLLGLLKDSSCDLIYDLFEKVRGNAAD
SGKGRSKQVPTASGQFKKSLHSLMERLSSANPFFVRCVKPNILKVPDNFNASIVLNQLRY
SGMLETVRVRKAGFPVRRLYKDFWERYCVVCPNAGDLPEPRDRAKAALNQVDREGGLWRL
GETKVFMKEILEQMLEKVRAEKVYGSAVIVQSVVRAYAARKYFLKLKACSIHAQRFVRGF
IARRRFHKACAAILRIQKMERGRQARKLFAVMIFEKREQDRLRNSAALEQMERERREREE
QVESHHERQRLEREELERQQRELEEKAAREAALSLPPDIPSPTKENFPSPPAMDELPPLP
TADILTLSPTKSENARVRNCIKYLNLFFVQYNKKVISSKNFKQMLLSAMANLDAVIDAAA
FDSAYSTANKRTFSEQDDYLEEQEKLEMDRILQLELEISQMHRRSEARASVISMSMEVSE
EQWFDGKYRCRVSTECPRSIPRQRKGGRNKRNGHITALCYLQNPQPWNDNEDSGNVDVLP
TSSSDLEDDFLSIAHTCFESLAYTMDPKSAWCFGSRIIKSYYTDSSFDDDDLSDTDTNAS
GQDQTERWNPNVYFHSYLDMKGGLMSQWKRRWCVISNSTFMFFRSKQDSLKCGWLLKKSD
SGKGTLRGTLPRKHWQRKWVALRNHEMKIYDNDDENAKCKMTIDLSTITDVTDVTEKENG
IDVIMSNKAHHFAAESTEEANEWYSILMKILSSSEQEIASMESEFANPKNAIGSIDGQTI
TAVTATTVSGKSNTFSITTSQRAYVLACDGVEEMHHWITLLNESMNSANSADSSSAVQQG
WMMRSFVERQRVTHQRRWFVLKPNVIEYYKSSDRGAQKLGSMGLNSLCLVTSPDESVFKQ
TGLWEIKVFGRKHTLMLSTEKEEDANLWSSEIQSMIDSQPLIVTKTKLLIDKMKQIADDD
KECTLLYKRNPILRQSQQPLRSPLLPLPYEQVASQDGHYTLRDSAIRFFDRLLLMEEQSY
TSIEQEASIIQELLRICHGSKAFQDEVYLQLIKQTAQMCEQQHVTTCPHYWHLIACMCCA
YHPSRPVMQYLKFHLKRTKERYPETPGGIYAAFAEKAVNLQTSRRREMVPSIPEICAALE
RRDLVTVIKCYGGATCDIYIDSFTTAGQVVQKLRRGMQLEGNRNTFALFEKKGTEERALE
PATFLSDVLAKFEALNQESGVESGELEWELYFKLYCVFDPMEVKEDSIEYHFVFEDVHEQ
VIHGLYPANEDILRELAALRLQFVMGNYTQLDWVREAYEITSNVDFKEKRSGSFGSNLSD
TNTISKKRSSSIFHTLRKKGMKKVKEADEENVEMKKTLYQEELQDVRSNVADRWRKLRGM
QPEEAVVEYVSLARTWPGYGSYLFKVENNEAQFGESRLSLAVASKGVTVYKRGHAAALDH
FSFENILSFGATSATVFRLQTGSRGDLTFNADEVTEIVKLMRAYVQALYKRHH
Download sequence
Identical sequences H2ZET3
51511.ENSCSAVP00000016099 ENSCSAVP00000016099 ENSCSAVP00000016099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]