SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016125 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016125
Domain Number 1 Region: 551-856
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-71
Family Protein kinases, catalytic subunit 0.0000292
Further Details:      
 
Domain Number 2 Region: 408-506
Classification Level Classification E-value
Superfamily PH domain-like 3.62e-18
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 122-181
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.99e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00092
Further Details:      
 
Domain Number 4 Region: 249-311
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000269
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016125   Gene: ENSCSAVG00000009491   Transcript: ENSCSAVT00000016306
Sequence length 874
Comment pep:novel reftig:CSAV2.0:reftig_15:2049811:2058748:-1 gene:ENSCSAVG00000009491 transcript:ENSCSAVT00000016306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQFYFQIGFHREQVVVKRSELSLVALKELAVAVLEKQFPQAQICLRLAQQIHLFQHQPNH
DNILKVMKSSDEMKDGALIEVVLSVHRVLISSYVSAQIWHRKLGRKFLTNYKSVTTGGRT
MQCDNMKIRPHTLSVHSYRSPAFCDYCGEMLWGIVRQGLRCDGCGQNYHKRCAYKIPNDC
TLVRKRKASVSASVNTWNGSTLSLQDSRRIYRYAHSLIHREPSVQRLAFQVVSLYPSTQR
SGRTYSCRPLWMERSLAIRVPHAFQVHSYTRPTVCMQCKKLLRGFFKQGVQCKCKFNCHK
RCKNDVPANCPEEETKSNKYNIVLSYDSTRSKHCYNPHRSETDADDIVDSDDGMDTSDPF
DPPTPSAPVEEDESTENSMAVESSDAPNIPLMRVVQSIKQTKKRSSTVLKEGWLIHFTNK
DSVRRRHYWRLDSKSITLYRSETGANYFKEIELSDILSILMVTRLLPGEPLHFFKILTSG
LELLVSDDSGEMSENVVDWHTQVYQALTPVDRKQDSTSGVKRKVSVMISLTKDPEDSKAT
DISQIYQVFPDEVLGSGQFGTVYGGKHRKRGFDVAIKVVDKLRFQHKEESQLRHEVQILE
VGKLFALKKLRTNNVVFQWLDHPGIVKLFNMFETPEQVFVVMEKLRGDMLEMILSSEKGR
LPERITKFLISQILIALRYLHKQNIVHCDLKPENVLLSSDDAFPQVNSLIPQPPFNFLDY
CLIFPSQLKLCDFGFARIIGQKSFRRSVVGTPAYLAPEVLRKECYNRSLDMWSVGVIIYV
SLSGTFPFNEDEDINQQIQNAAFMYPAHPWSGISHDSVDLIGSLLQVKKRKRPSVDKALS
HIWLQDYQCWQDLRQLEQVVGKRYLTHESDDDRW
Download sequence
Identical sequences H2ZEV9
51511.ENSCSAVP00000016125 ENSCSAVP00000016125 ENSCSAVP00000016125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]