SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016773 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016773
Domain Number 1 Region: 261-514
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.11e-72
Family Protein kinases, catalytic subunit 0.00000000542
Further Details:      
 
Domain Number 2 Region: 151-295
Classification Level Classification E-value
Superfamily SH2 domain 1.04e-37
Family SH2 domain 0.0000214
Further Details:      
 
Domain Number 3 Region: 81-160
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-24
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016773   Gene: ENSCSAVG00000009867   Transcript: ENSCSAVT00000016955
Sequence length 514
Comment pep:novel reftig:CSAV2.0:reftig_30:2947175:2956766:1 gene:ENSCSAVG00000009867 transcript:ENSCSAVT00000016955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCCTSKEKDNGGVTSVDGGTHYARDPGINSNPVVISGPQMSSGPVSDSSRNTNQFGGFN
PGQMPLFNQTQSGMVPIKGMPSRPSMTGQAVRYVALYDYDARTADDLSFKKGEQLFILNS
TEGDWWEARSLITQDTGYIPSNYVAPANSVQCEEWFFGKIGRKDSERLLMNQENIRGTFL
IRESETAQGTFSLSILDEDQAKGLNVKHYRIRKLDSGGFYITARAQFETLKHLVDHYQNV
ADGLCCRLLDPCPLLEKPQTITIARDVWEIPRESLKLEKKLGAGMFGEVWKGLWNGTTEV
AIKTLKPGTMSPEAFLAEAKIMKMLRHEKLVSLYAVVSKEPIYIVTEYMCHGSLLDYLKE
GQGHKSNLVDQIDMAAQIAGGMAYIERMNYIHRDVRAANILVGKNQVCKIADFGLARLIV
DDEYSARQGAKFPIKWTAPEAAMYGKFTIKSDVWSFGILLTEIVTKGRIPYPGMMNREVL
EQVERGYRMPKPTLLPNDPPCPDSLYDLMLQCWN
Download sequence
Identical sequences H2ZGQ7
51511.ENSCSAVP00000016773 ENSCSAVP00000016773 ENSCSAVP00000016773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]