SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000018360 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000018360
Domain Number 1 Region: 218-255
Classification Level Classification E-value
Superfamily PH domain-like 0.00000101
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000018360   Gene: ENSCSAVG00000010779   Transcript: ENSCSAVT00000018560
Sequence length 259
Comment pep:novel reftig:CSAV2.0:reftig_1:3279472:3285920:-1 gene:ENSCSAVG00000010779 transcript:ENSCSAVT00000018560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRPSLTNDEQLWLMKQVKMSCMTVDEAVSWTEARTNEIQLEEETNNISKDKKSFKPGK
TLKKFLPRRSRNKSSDGNNASIVRKPVERSSVSSEEHVETSGNQDLRSKQVYNFSIYKCS
KHKVPQKRIMQIDFGAKVISLIHHGNLLTNYPFSSLVNVDGQEGKKVFIYFDDSQELELN
AENLADKTKLIRLLNVISEQNEYEERGQPFDPCEKLQLSFKIIKEGYLEKKGAYSAINWN
KRLVVIRSGELAYYRVEEE
Download sequence
Identical sequences H2ZL94
ENSCSAVP00000018360 ENSCSAVP00000018360 51511.ENSCSAVP00000018360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]