SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000018813 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000018813
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.11e-19
Family Canonical RBD 0.0027
Further Details:      
 
Domain Number 2 Region: 190-262
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 79-178
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000148
Family Canonical RBD 0.017
Further Details:      
 
Domain Number 4 Region: 418-489
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 5 Region: 277-355
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 498-572
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000018813   Gene: ENSCSAVG00000011054   Transcript: ENSCSAVT00000019019
Sequence length 580
Comment pep:novel reftig:CSAV2.0:reftig_9:3161488:3163227:-1 gene:ENSCSAVG00000011054 transcript:ENSCSAVT00000019019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVYIGNLPQDVAVEALCDVFASCSIELSNVVVNQKGFAFADCKDANQTDRAIECMNGF
SYGGKEMSVEHSVPRGSRSRKVQVRNIPSHLNWEELDKLLAEYGVVENCEQVSTESDTAT
VKVTYSGRSEAQSAIRDLNGKTVEGSILKVTLLPDPTDASRPPRNRFVNGYGGPFNNQQQ
GFVRPKNIPELPTRMLVPSQYVGAIIGKGGESIRAITQKTHARIDVHRKDNPGATEKAIT
INGTPEACGAAVAAILDIVRDEDRTARQAAGTYNDDDIPLKILAHNSLIGRLIGKEGRNL
KAIQEKVETKIAISNSMAEMQHFNAERTIAIYGDNDRCAEAEVLLMEKLRSCYESDMMIA
QQQPQQYPGLNMNQLSMFAGLHGGYGHPMRDYGMPPNYQGQNYRGQGGFNGDRAQMSETC
TLYIPAESVGAMIGSKGSHIRNISRIANASIKIVPPEDGDDEKQRRVTIMGSPEGQWKSQ
FCIFDKLKQEGFFNAEDERLTSELTIPAAIVGRVIGKGGNNVRELQRLTSSEVVIPRQSE
TEGMEEVPVKICGNFFANQSAQRKIRELLMKSREAERMGK
Download sequence
Identical sequences H2ZMJ7
51511.ENSCSAVP00000018813 ENSCSAVP00000018813 ENSCSAVP00000018813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]