SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019023 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019023
Domain Number 1 Region: 98-204
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-32
Family Second domain of FERM 0.0000105
Further Details:      
 
Domain Number 2 Region: 206-344
Classification Level Classification E-value
Superfamily PH domain-like 3.04e-30
Family Third domain of FERM 0.0000295
Further Details:      
 
Domain Number 3 Region: 5-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-20
Family First domain of FERM 0.0003
Further Details:      
 
Domain Number 4 Region: 507-548
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0000017
Family Moesin tail domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019023
Domain Number - Region: 417-462
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0294
Family Outer membrane lipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019023   Gene: ENSCSAVG00000011164   Transcript: ENSCSAVT00000019230
Sequence length 548
Comment pep:known reftig:CSAV2.0:reftig_64:159202:167903:-1 gene:ENSCSAVG00000011164 transcript:ENSCSAVT00000019230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKKKGKQISVKISTLDADLNFSVDSFSKANYVFDLVCHTIGLRETWYFGLAYTGKNGSLV
WLKLDKRIIDQNVPRSSENGSVELKFFAKFYPEVLDVELIQEVTRHLFYLQLQQLVLSEK
LTCTPEAAILLASYAVQAKFGDYDEEIHKPGFLANEVLLPQQVIDQYQSVTGQMWEAQIT
PWYAGHHGLTRDEAELEYLKIVQEFEMSGVEYFKIKDGNGLDLWLGIDAKSISMYPFSDK
LHHTKSYQWSQLADMSYCGNKFVIKQTQKLASDLVFLVDDPEVNKVILDLCRGNHELFMQ
RRSVDSMEIQQMKEQAREEKARKQLERTRLEKEKNLRLMLQNEKKEIEEKLLQFQEEHRS
TGEALRRSEETADLLEKAKVAEEEALLLRAKLGKSDQELQSLKLEIVQLKDVNHQLSQKL
HKYEQYVQQLNEQGQARTAEMSHIREELYATQSALNEANMKLNLFANQHVVLYVPPFTPL
DLSTIPQTLPTTSLVDRNSNEISIVNPDMQQLSQEIEKERVEYHVKSRNIEQQLFNLRSE
IEVLKVDE
Download sequence
Identical sequences H2ZN57
ENSCSAVP00000019023 ENSCSAVP00000019023 51511.ENSCSAVP00000019023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]