SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019915 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019915
Domain Number 1 Region: 2312-2500
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.57e-47
Family I/LWEQ domain 0.00018
Further Details:      
 
Domain Number 2 Region: 507-666
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.06e-46
Family A middle domain of Talin 1 0.00000953
Further Details:      
 
Domain Number 3 Region: 680-800
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.8e-42
Family I/LWEQ domain 0.0000221
Further Details:      
 
Domain Number 4 Region: 773-904
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.31e-36
Family I/LWEQ domain 0.0000364
Further Details:      
 
Domain Number 5 Region: 1247-1384
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.92e-34
Family VBS domain 0.017
Further Details:      
 
Domain Number 6 Region: 200-314
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-30
Family Second domain of FERM 0.00000657
Further Details:      
 
Domain Number 7 Region: 315-405
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-23
Family Third domain of FERM 0.0000193
Further Details:      
 
Domain Number 8 Region: 1091-1230
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.14e-20
Family VBS domain 0.026
Further Details:      
 
Domain Number 9 Region: 1491-1578
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000405
Family I/LWEQ domain 0.0071
Further Details:      
 
Domain Number 10 Region: 1868-1987
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000596
Family VBS domain 0.0005
Further Details:      
 
Domain Number 11 Region: 2022-2147
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000502
Family VBS domain 0.015
Further Details:      
 
Domain Number 12 Region: 1712-1838
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000173
Family VBS domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019915
Domain Number - Region: 81-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000304
Family Ubiquitin-related 0.058
Further Details:      
 
Domain Number - Region: 1604-1682
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000612
Family VBS domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019915   Gene: ENSCSAVG00000011698   Transcript: ENSCSAVT00000020129
Sequence length 2550
Comment pep:known reftig:CSAV2.0:reftig_1:5458147:5499718:1 gene:ENSCSAVG00000011698 transcript:ENSCSAVT00000020129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNLALKILIKQSNMTRTMQFDPACIVYDACRIIREKTPEAQVGLAQDYSLFLADKDPKK
GVWLESRRPLEYYLLRDGDILEYKQKQRPLKVRTLDASIKTVMIDDSNTVDQLMITICTR
LGIVNHEEYSLVRDAIVDEAPAQKKASFDTGTLLRPGTTDRKFETLKKKLHTDDELSWLS
HGQTLREQGVDELETLILRRKYFYSDQNVDSRDPIQLNLLYVQSRDGILKGQYPVSEKDA
TTFAAIQCQIQLGNHDEKKHKPGYIELKDFLPKEYVKSRGIEKKIFAEHKLFENLSEIEA
KVKYTKNCRALKTYGVTFFLVKEKMKGRNKLVPRLMGVTRESVMRVDEKTKDMLKVWPLT
SVKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKRQAKDNIGIDDD
EDAAIVEDTVSPHQAQFVAMHGGSAGSFHSGSVAMPGVIGNSSARPDSYSMGAMQPPTQV
TTHSNLSYGGQPLHHHQTRSFLKHIITAAQQAFMGNIEHGFNACRAAHEGFNNKAHLPPL
GSDAASRQWKMNAVAENRHHIQSNLAAIDAATATVITKTSGDPEGRSYTTVGSAITTISS
NLNDMTRSMQLMASLLDDGSDGDGLMRAARDLTAAIQDLLRAAKPNSEEPRQNLLGAAGK
IGASHDILKYIGDGGDDEFQASRDILMNLAKQVASATAALVLQAKTVASQSQDQITQNDV
ITSATKCALSTSQLVACTKVVGPTIYNPSCKEQLIDAAREVSHSVDGCLESTRVATNDPN
LLQALGDAASNVGKALNDLINHIRSGADMTNGKYDDQCEVILNATDKLCNSMGNAAVMAK
QAKLLGQATSDLVNLLKLEADEAQDDDWRKWLLSTVKLVAEATAKMVEAAKGTASNPHDS
QQQQNLKLAAENLRAATNAATQNALRKKMIRRLEEAASHAAVAATQTIAAANAAEPYNTN
KTSQNQLLTHSKSLQSEHIPKLLQSIHGAYDDLKNPTVQQNLITASNEFVPPATKMVGYS
KAVVPTVSEKSTALQLANCTKKLALAVAELKTASVKAGEVCGASGIDAALETVTALDRQL
SVYCNDAKNNQLQPLPGQTMQHCAQELGATSKAVGASMAQLLTRSSSVRNCSPQGNEDYT
GMAARYTANALRTLVGAARGVAANLPDLDSQLHLLETCRDVMDKSVNLMQEAKLAVEDPE
NPENRQRLAQVAKAVSHALNNCINCLPGQRDVDEALKNIAESSKRLLSNQFPVNNANFQT
AQAQLNRTAEELNIAANDLVGASRGTPSELAASSTNYNDRFTELLDAGMNVAGQSRDKDD
QGQVIGNLKSISMASSKLLLAAKALSADPGAPNAKNQLSAAARAVTESINNLITHCTETA
PGQKECDNALRQLKTVKEMLENPNEPVNDFSYFDCLESVMDNSKMLGESMSGITQHARAS
ELESFGEAVTATQKSLIGLTEAAAQAAYLVGIADPNSEAGTQGLVDQTQFARANQAIQMA
CQSLLDPSSNQPQVLSAATIVAKYTSALCNVCRVASNKTTNTVARKHFVHSAKEVAHATA
NLVRTIKALDGNFSEENRANCSQATKPLIDAVENLTTFASNPEFASVPAKISNEAREAQR
PIIESGKQMLESSSELIKTARKLANNPKDPPTWQVMAGHSRVVSDSIKKLIANIRDNAPG
QKECDEAIDRINESIQQFNDASLSAMDQSLPARDDNSLNGFQAMVVDTVNQINKCVDPLA
NAAKEDAAQLGRQVVAQMASYFEPLAHATIGAASNSVNHQRQMDILDYSKTLAESALQLM
FAAKEGGGNPKADNTHEAIDEAAESMKEAIEDLLKSVQEAPEALMSGMVDTICSATAVSS
CFYGSWEDDTFADYQTSIMRHCRAIVVTSSDMSMAMNTRPDELTTLAKKVTGDFKETIKL
SYTFRLKLKINVSNHIKRSIQDLGEACKELQSAGTIPLTKKDLNRMLARTSIEKVSYVMS
SLQEGGRGTQACINAHTKVQGIIGDLDTTLMFVTSGALNPESDNESFAEHRENILATAKA
LVEDTKQLVAGAAGGQEKLAGAAQSASQTISKLADVVKSGASSLGADDPDTQVILINAVR
DVASALADLINSTKDASGKSTSDQSMLHLKASAKAMVTNVTSLLKTVKSVEDEAAKGPRA
IEQTINSIKQELKVNFKHIRILMERRATPEELIQITKPITNATAKAVAAGKFCRQEDMIV
CANMGRKAVFDMIHICRASAASTDDQVQQKETLKFGAGVAEAYVSLLSNVLLTSQQPGNN
DLKKNLNPLSKNVATAVSNLVRSGESMKGTDWVDPNDPNVIAEQELLAAALSIEAAAKKL
AQLRPRKKPKQADESLNFEEQILEAAKSIATATTALVKAASAAQKELVLQGKVGSIAAMR
HDDGQWSQGLISAAQMVARATGNLCEAANQAVQGEASEEKLVTSAKQVASSTAQLLVACK
VKADPNSENMKRLQIAGNAVKHASEDLVKAASESANSDDEVEVVINSRLVGGIAQEMMAQ
EEILRKERELQSARQKLAQIRRMRYKDDSD
Download sequence
Identical sequences H2ZQP9
ENSCSAVP00000019915 ENSCSAVP00000019915 51511.ENSCSAVP00000019915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]