SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000020122 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000020122
Domain Number 1 Region: 94-183
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000172
Family Third domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000020122
Domain Number - Region: 43-94
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0942
Family DNA polymerase beta, N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000020122   Gene: ENSCSAVG00000011809   Transcript: ENSCSAVT00000020338
Sequence length 207
Comment pep:novel reftig:CSAV2.0:reftig_1:6385814:6388451:1 gene:ENSCSAVG00000011809 transcript:ENSCSAVT00000020338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADASYENEVQNFRTLLKLQKSGSGNGSAAGDQTLQLSTNIEPQFYVARRHLRKLGNKVV
TRKIQESVTNYSSYNLINAKLAYIKAWQALPEYGITHYYVRFRNSRRDELAAIAFNRIIR
MDPNSGEALKTWRFNTMKAWSVNWDTNQVIIELAEEEHNIEFACTRFSPKLVHELIGGYI
FLSMRTKDADEALDDENFFKLTGGWNG
Download sequence
Identical sequences H2ZRA6
ENSCSAVP00000020122 51511.ENSCSAVP00000020122 ENSCSAVP00000020122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]