SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|1002747|fgenesh1_kg.41_#_111_#_Locus6803v1rpkm23.92 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|1002747|fgenesh1_kg.41_#_111_#_Locus6803v1rpkm23.92
Domain Number 1 Region: 22-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000133
Family Glutathione S-transferase (GST), N-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 95-240
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000355
Family Glutathione S-transferase (GST), C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|1002747|fgenesh1_kg.41_#_111_#_Locus6803v1rpkm23.92
Sequence length 258
Sequence
MANPETHIVLCAPPKPKGAPSFSGFCEKLEAFLRYSGISYEHREVYPYQGPKKKVPFAEI
RHDGKTTIVADSHFIIRYLIENKLAKDPDDLAELTPEQRAESRAFQAYVEETLYSAIVYE
RWLVPGNFQVTKRDTFGNLPWLLQYFMGWYFLRKVGNNLWAAGMGRHSWEEVRTLQKEVL
DVLEAKLRKHKYFHGDERPSRIDLTVYGFLANILTCEGNPYFTDMILKSTVLSSFVKEMT
TALFPEYKDVLKKVGGDT
Download sequence
Identical sequences A0A0C3JX64
jgi|Pisti1|1002747|fgenesh1_kg.41_#_111_#_Locus6803v1rpkm23.92

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]