SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|157412|e_gw1.71.64.1 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|157412|e_gw1.71.64.1
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-36
Family spliceosomal protein U5-15Kd 0.000000843
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|157412|e_gw1.71.64.1
Sequence length 142
Sequence
MSYFLPHLPSGWHVDEAIKSEEDRIVVIRFGHDWDPQCMTMDETLYAIAEKVQNFAVIYL
VDITAVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY
RGASKGRGLVVSPKDYSTRYRY
Download sequence
Identical sequences A0A0C3INN6 A0A0C9ZG29
jgi|Pismi1|683760|fgenesh1_kg.111_#_71_#_Pisolithus_microcarpus_c1084 jgi|Pisti1|157412|e_gw1.71.64.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]