SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|19593|gm1.2212_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|19593|gm1.2212_g
Domain Number 1 Region: 353-442,471-541,610-654,726-795,916-1014
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.63e-43
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 2 Region: 241-348
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0026
Further Details:      
 
Domain Number 3 Region: 135-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.6e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0017
Further Details:      
 
Domain Number 4 Region: 979-1112
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-16
Family WD40-repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|19593|gm1.2212_g
Sequence length 1117
Sequence
MSSSCDALLRALKTCLLESDCVQKDGRLPSDCLKHHTDELPQPCQNLRKATFECKRNMLD
MRKRFRGNTVGMGAEKLRREQTNRPLLDPIIYSPLAREMTKLPGMCTIYKIPSHLQSIRP
RLPPPFTRTHTQISTMAKPLLVYIAPTPNGHKVSTVLEELKAAYGTNVIDYDYEEIVLST
NRQKEPWFIALNPNGRIPVLVDRSHKPTPFTVFESGAILLYLVRKYDLEGRFTFPAGSDE
ESELLQWIFFAHGGIGPMQGQARHFRQVAPVDIPYGKQRYTEETARLYGVLNIRLEGRDY
LVGPGRGKLTIADLNAFPWVRLHEGAGIDLDAFPNVKAWVDRIAERPADANDNGVHETLP
GHEGTVTCLQFLRNNFFLSADDKGAVRAWHRAEGRWMCTVAIQAHSRPISALAVCDNLVA
TGSSDSSVKIWDIRQGAERDELEECQTISLSGRYPLAVVMTMLPHSKAIILAIGGTDRNV
NIWTRSENLFVRSATLPGHEDWVRALAFRSPLSSDGAANDDPLVLASGSQDGTIRLWNIE
PLVKSASSINDHHVNDSGSTDELLDAFEASLADPTEGEEGGRQITLKRHIISIKFQDTGV
QQYTITFDALLIGHEAGVTSLSWASQQTSTGNYLPPPTLLSTSTDSSLILWSPSDTLITS
SSNSPAAPSIWINRQRFGDVGGQRLGGFVGGIWAHTSQGDEAMAWGWSGGWRRWRSVRMN
TGIEDEWREVGAIGGHRGPVKDVAWSPAGEYLISVGLDQTTRIHGALPCPSRKVWHEVAR
PQVHGYDLVGVTWLGPWTFASVADEKVVRIFEAPGTFVETVKSLGVDGVVESEQNRPVAA
SVPPLGLSNKATSDAPPRVNSTRSGRRPFEGELAATTLWPEVEKVFGHGYESITIASSHS
HELIATACRASSPQHAVVRLYSASTYQSFGSPLEGHTLTVTRIAFSPDDKYIVTVSRDRT
WRAFVRKDNGYVSVAMDKSHARIIWDCAWSSEGDIFATASRDKTVKIWAPKTTSDRWPAL
ATLKFKEAATAVAFCSMDNLRQLLAVGLETGEIFIYSGSKSGPDIWELTFVVGRGTAHVD
HIHKLAWHSTEHDHIKQLASCSEDGTLKIMTVQVDID
Download sequence
Identical sequences A0A0C3PVL7
jgi|Pisti1|19593|gm1.2212_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]