SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|20562|gm1.3181_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|20562|gm1.3181_g
Domain Number 1 Region: 144-274
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.34e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0097
Further Details:      
 
Domain Number 2 Region: 64-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000968
Family Glutathione S-transferase (GST), N-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|20562|gm1.3181_g
Sequence length 282
Sequence
MATTTPQALMRAKHSDEHQGGSSNMLVDIGHLKSDQESYIKLVVKPCLLQLTLQAFHANM
TPIGKMYGYGSQPQTKAILSVATLSNLEIELLPFEYGVTNQSPEFTLKFPLARIPAFESL
NGFKLTEGATIARYVSSLVPDAGLLGCNAEETALVDQWVHFAEFEIYMDASMIYAGAGLK
LLPGYNADRHKWHEERIVRSLRFLDNYLEKRPSGLLVNDNITLADIFSAIATERAGQTTC
GTAEREQTYPHVFAHHAKVTSDERIKDVLGGPGFIEERLVYN
Download sequence
Identical sequences A0A0C3PR39
jgi|Pisti1|20562|gm1.3181_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]