SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|212523|CE39630_1331 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|212523|CE39630_1331
Domain Number 1 Region: 85-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.76e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0083
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000166
Family Glutathione S-transferase (GST), N-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|212523|CE39630_1331
Sequence length 223
Sequence
MTLIGKLYGHILQPQTKVIMSVAALSNLEIDLLPFEYGVTNQSPEFIQKFPLGKVPAFES
LNGFKLTEGAAIARYVSSLVPDAGLLGRNAEETALVDQWVHFTEFEIHMDASMIYAGAGL
NMLPGYNADRHKWHEERIVRSLRFLDNYLEKRPSGLLVNDNITLADIFLAVAIQRVGQTA
CGTAEREQTYPHVFAHYAKVMSEEKIKAVFGEPEFIEERLVCN
Download sequence
Identical sequences A0A0C3KJP9
jgi|Pisti1|212523|CE39630_1331 jgi|Pisti1|830202|CE657309_1311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]