SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|23200|gm1.5819_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|23200|gm1.5819_g
Domain Number 1 Region: 6-148,245-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.95e-38
Family FAD-linked reductases, N-terminal domain 0.0052
Further Details:      
 
Weak hits

Sequence:  jgi|Pisti1|23200|gm1.5819_g
Domain Number - Region: 488-547
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0217
Family Glutathione peroxidase-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|23200|gm1.5819_g
Sequence length 554
Sequence
MAAGTTPVLVAGAGPTGLIAALTLAQINVLVRIIDKEPQHRPGQRGPGIQPRTFELFHIP
RIPEIHEVQLFFPRFTSTTKVLSKSSEHLSRHHIRSPCQRFHTFGCTVELGTRLVSFTQD
DKCARAKTVKHRTDDGAKSVTRKLLELTFVGSAWEDGYIVLGDIRLEIKGLDREHWHHFG
HFSKDIISFRPTDEVGKDEYQFMISSCIRDLKGLAQDEVALVNCIKDFVGLGDDVNVKEV
MWVSKSKPHTRMVNKFGVGRAFVAGDAAHVHSQTGGQGLNSGIQDALNLAWKLALVYKGL
SPTSLLDTYSAERLPVIAEVLTVTAEMYKRTYREPQAEHTPRSTTDDKDNDSSELSGSKL
QRSLHRGKNLYMLGVNYRTSPIVIDEFTPAPTSADAHRAYGDIQEGVLQAGDRAPDAPDL
APVFTPNRAAPTSSTPSTEVPESTRLFDIFAPTYHTVLIFTPALTFPAVRSVFAALKQSI
AKSESNQIIGVEIFVDQAGHAYRGYIVEREQIKVVVVHPDGVVVAVVGGAEGLEQYFEGV
FGKKGGVHLVKDVV
Download sequence
Identical sequences A0A0C3KEA3
jgi|Pisti1|23200|gm1.5819_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]