SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|24170|gm1.6789_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|24170|gm1.6789_g
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.08e-32
Family Thioltransferase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|24170|gm1.6789_g
Sequence length 108
Sequence
MVEKIESMEQFQKLINGDVPVVIDCYADWCGPCRTIAPIFAKLSDEFTQVKFYKLNIDEQ
QDISNKLQIRSIPAFFIFRKGNKIEELVGANPSALRVRIHRSLAGCPS
Download sequence
Identical sequences A0A0C3PFJ3
jgi|Pisti1|24170|gm1.6789_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]