SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|24772|gm1.7391_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|24772|gm1.7391_g
Domain Number 1 Region: 230-341
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.84e-20
Family Thioltransferase 0.0091
Further Details:      
 
Domain Number 2 Region: 482-625
Classification Level Classification E-value
Superfamily ARM repeat 0.0000779
Family RPA1889-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|24772|gm1.7391_g
Sequence length 662
Sequence
MSTPVQLYVYDLSNGLARQMSMQLTGRQIDGIWHTSVVVFGKEIFYGQGINITPPGKSHL
GQPFRIVEMGETAIDEDTFEQYLSEMGQQFTADKASEALPLCTDITFNMSQSRSQYHLLD
FNCNTFSNECIGFLTGGNIPDYIKSLPADFLSTPFGAALRPSIDAMFRGGAHSGLPTPPP
EAVRAAAQVSPNPALATGLLESIAARASSSGYAESYIPTPAPTSPPTPVAADVKDCTDLT
YFQSLLRDNRAVIAFFTSKTCGPCRVVEPVFQDLAKQKAKRNGGVVFAKVDLAVGAGAAV
ASRYGVRATPTFFFFLDGRKASTHELRGANAPELRTQVDLLLYEAFPPHPHRSISLPATD
SIALKPILFTQIPNLDTLLSKLNEFIDAVSPWTGVLTQAQIKQALSKTVIPFLKASSTPP
PPQPPTAPFDYWPALVLGLVSNLTVGDLFPLADIWRIALLNPKFSEWSAVKKGPQNPMNV
LLSKALGSKDVPRNYLLTVLRMLSNAFSNTNLARECTTSMRNDLTAILVSSLLHENATVR
TAAASLAFNVAAHFQKRRLERIESHGNIDPEEEDLDWELEIISALLEAIGRENASEDTVH
RLTASLALLLRFSPFTRDLTPLMEVLRSRSVLTGKLQKGNTGGVTKVEIRKLITEVAEKL
CP
Download sequence
Identical sequences A0A0C3JAC5
jgi|Pisti1|24772|gm1.7391_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]