SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|28773|gm1.11392_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pisti1|28773|gm1.11392_g
Domain Number - Region: 114-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0235
Family Thioltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|28773|gm1.11392_g
Sequence length 616
Sequence
MAQRCDASSQYLSDDAPPPLSAERSSDDWSPFQNWLEFELMDFLFRQAEMPAKKIDMLLE
IWATLLLALHGEPLFTNQKDLYHIINSTSVGEVKWESFVVWYANNGQDGQDSNMAPWMLD
SYDNWCPKCLAHWESLDDDVLHHCCEHADAVIQEFDFHKLWDTYGIVGNIVLFTNDFPHA
DIYSMLSPDILHQLIKGGFKDHLVDWVECYLIHIHGKTQAEKVLDEIDWQIAAVAPYTGL
RHFPQGQHFKQWTGDDSKSLMKVYIAAIEGYVPQYIVFTFRAFLEFCYLICWNVITQQML
VEIDDALRHFHLYREVFRNAGVVDTFSLPRQHAMKHYSHLICQFGAPNSLCSSITESKHI
KAIKRPFTCTWGSSNADDPCDQVGESRDMANEIEEQAGSYEEELGDAIDAPRSVEAHVSL
ARTHCALAAELCLPQLPNILHHFLYSQLFPTDDLDDIVLNECSPYDGSVHVYNSACSTFF
ALSDLCGLYGMHCEHIRSCPMWRNEGPCFNCIFVVTDPEAEGTLHPCAVVCWFNRMGDGP
DKATGMWIICPSYNAHNVPHIAIIHINVIYHAAHLIPVYAAHNINTRDIKPHDSYDTFNS
FYVNKFADHHAFEIAF
Download sequence
Identical sequences A0A0C3P2E7
jgi|Pisti1|28773|gm1.11392_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]