SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|340113|CE167220_2256 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|340113|CE167220_2256
Domain Number 1 Region: 5-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000229
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|340113|CE167220_2256
Sequence length 144
Sequence
MDQGLHLAYFPFRGRGEPILLLLVDSGVPFNLEEIPVVTWEQWKKTREITSDKFPYSALP
VLRVRHEVVQNGPKEFVLAETSTILTYLNETLAPAGTTLEKDLPLEVRVRIQMVKEAALF
AMVRILGMSGSSELPHRGPPSAAS
Download sequence
Identical sequences A0A0C3JGL5
jgi|Pisti1|340113|CE167220_2256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]