SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|579621|CE406728_3088 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|579621|CE406728_3088
Domain Number 1 Region: 17-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000057
Family Thioltransferase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|579621|CE406728_3088
Sequence length 76
Sequence
MISPILKKLTGDASLKTGSGRSLDLVTIDTEKQMELAQRYRVMSLPTVIAFKDGKPASQF
IGALDEAGIKQFLQQL
Download sequence
Identical sequences A0A0C3PVY5
jgi|Pisti1|579621|CE406728_3088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]