SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|605208|CE432315_75 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|605208|CE432315_75
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000478
Family Glutathione S-transferase (GST), N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|605208|CE432315_75
Sequence length 76
Sequence
MAPIGKLYGHPRQPQTRAILSALTISGLEIDLPPFELGVTNKLPEFTHKFPLAKIPAFED
NEGFKLIEGATIARYG
Download sequence
Identical sequences A0A0C3MVT2
jgi|Pisti1|605208|CE432315_75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]