SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|648417|CE475524_81069 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|648417|CE475524_81069
Domain Number 1 Region: 5-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.82e-67
Family Glutathione peroxidase-like 0.000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|648417|CE475524_81069
Sequence length 212
Sequence
MVAVVQKPAPPFKATAVVEGLFKDIALADFQGQWVILFFYPMDFTFVCPTEILAFNDALP
QFKELGAVVLGVSTDSQYSHFAWAQQPRKQGGLGPDLSLPLIADRNMQISREYGVLIEED
GIALRGLFIIDPKGVVRQITINDLPVGRSVDETLRLLKAFQFVEKHGEVCPLGWTEGSRT
IKPDPKGSLDYFSAVDNDIGMQDGTARKRAQP
Download sequence
Identical sequences A0A0C3J064
jgi|Pisti1|648417|CE475524_81069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]