SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|693104|CE520211_6365 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|693104|CE520211_6365
Domain Number 1 Region: 30-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-17
Family Selenoprotein W-related 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|693104|CE520211_6365
Sequence length 129
Sequence
MMESKDKGEQREDALLDPATFLPPSPLPAPTVTIEFCDRCRWLHRATWVSTELLLTFPPP
TLKAVTVMPLSADDTAGRFRIWLNVEGGPPKLMWDRKVEGGFPELKVLKQRIRDFIQPGM
SLGHSDKKA
Download sequence
Identical sequences A0A0C3PFS2
jgi|Pisti1|693104|CE520211_6365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]