SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|775255|CE602362_436 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|775255|CE602362_436
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-25
Family Thioltransferase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|775255|CE602362_436
Sequence length 105
Sequence
MSSAKDIVENAIANRRVVIFAKSYCPHCRASKQLLKELFPPGDILIFNLDLMEGGQAIQD
YLVVKTGKKTVPQTFINGHHIGGNDDLQEAYKNGTLQRVIEGLPA
Download sequence
Identical sequences A0A0C3NXA5
jgi|Pisti1|775255|CE602362_436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]