SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|939543|MIX11394_3818_22 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|939543|MIX11394_3818_22
Domain Number 1 Region: 45-224,321-414
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.97e-46
Family FAD-linked reductases, N-terminal domain 0.0045
Further Details:      
 
Weak hits

Sequence:  jgi|Pisti1|939543|MIX11394_3818_22
Domain Number - Region: 565-620
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000447
Family Glutathione peroxidase-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|939543|MIX11394_3818_22
Sequence length 630
Sequence
DLPARICGTARTVSQPDINPAFSQQRIKNTRLFRHSLAMEPCTAPILVVGAGPTGLTAAL
TLAQNNVPVRIIEKELHHRRGQRGPGIQPRTFEVFHFLHVPEIHERATFLPLLQEHNRGS
LEARKTFAMSPYTEPTPAIPYYNPKLMGQNTLEAILREHLAKFECTIELGTRLVSFTQDD
KCVKAKIVKHRADDGEEPEEEMEAAYLVGADGARGVTRKQLELAFVGSTLREDHVVLGDI
RLEVKGLDREYWHYFGTMSQDMISLRPTDELGKDGYQILIGSHVRDMKGLAQDEEALLNC
IKDFIGLGDDVNVKEVMWVSEFRPNMRMVNKFGMGRAFVAGGANSCPVHSPTGGQGLNTS
VQDAFNLAWKLALVYKGLSPASLLDTYTTERLPVITEMLGLTTEILKLTFGDDNTKKVES
NLERAMHRGKNMYMLGVNYRTSPIVVDEFAPVSTPGVAVVHSAYGSIQEGVLRAGDRAPD
APGLLRVLQTGGPGNTRLFDIFAPMYHTVLIFAPASVVPVVSSVLATLKQGVPINGLVRP
LIVLPGRPSDLDGGVETLSVQDQAADVEIFVDQAGHAYRGYFIEKDKTKVIVVRPDGVVG
AIARGAEGLGRYLEGVFGEKRGVGGKVEVM
Download sequence
Identical sequences A0A0C3KE98
jgi|Pisti1|939543|MIX11394_3818_22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]