SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|108916|gw1.18.1005.1 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|108916|gw1.18.1005.1
Domain Number 1 Region: 162-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000501
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 27-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000573
Family Glutathione S-transferase (GST), N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|108916|gw1.18.1005.1
Sequence length 239
Sequence
MIPLILYDFPSKLEGNHWSPSITWSYRFALGYKNLPFRVEWVEYPDLAPRMKEIGAKPSK
RLDGTEKYTLPVLSDPNTGALVTDSLEIAEYLEKTYLDKPIFSNKSKGLIRAFDSVVINL
LLAAFKFPIVRTSEILNERSAEFYIATRETMFEEKFTELSAEGLKREEHWTNLERMFNTS
QEWYDKEEGKWLMGDVFSYADIIVAAILFWLKRVLHDDEWEKIASWHDGKWAKLLVDVE
Download sequence
Identical sequences A0A0C3KBI9
jgi|Pisti1|108916|gw1.18.1005.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]