SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|12338|fgenesh1_pm.3_#_152 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|12338|fgenesh1_pm.3_#_152
Domain Number 1 Region: 34-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000616
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|12338|fgenesh1_pm.3_#_152
Sequence length 313
Sequence
MLRLIIALLCLPFCLAAQKSPRDELVQLASAGNGVIRLDERTFDLLTSPKRDWSAAIQLT
ALNPQRRCGPCKEFDPSFQAVAKAWSTVTPEQRNNHFFASIDFDDGFQVFKKLGIMSAPV
VHVYPAAEGPNAKTARNDPFKYDFSNGFEARPLAEQLSSHTPIPIPYKDPINWARIASFV
SLIPIVTLIFRFIRPALQNRWVWAAGTILLSTVMTSGYMFTRIRGTPYVGPDGGWLAAGF
QTQYGQEVQVVSLLYGVLAGSFVMLILLAPQQSSPTRQRTQIYIWTALNFILFSVLVSIF
RLKNRGYPFKLMF
Download sequence
Identical sequences A0A0C3KV64
jgi|Pisti1|12338|fgenesh1_pm.3_#_152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]