SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|13074|fgenesh1_pm.4_#_437 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|13074|fgenesh1_pm.4_#_437
Domain Number 1 Region: 28-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.93e-33
Family PDI-like 0.001
Further Details:      
 
Domain Number 2 Region: 355-477
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.65e-27
Family PDI-like 0.00073
Further Details:      
 
Domain Number 3 Region: 236-365
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.38e-25
Family PDI-like 0.00023
Further Details:      
 
Domain Number 4 Region: 137-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000636
Family PDI-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|13074|fgenesh1_pm.4_#_437
Sequence length 505
Sequence
MRFSSLLSTASAVALASIAAADADAEKPSDVINITQETFEAVVNSEPLILVEYFAPWCGH
CKALAPHYEEAATILKEKDIKLSKVDCVDQAELCQAHGIQGYPTLKVFRRGEATDYTGPR
KADGIVSYLIKQSLPAVSQVTAANLTEFQHADKIVAVAYVTSTSDAPATEFGAAAEKHRE
DYLFGITTDPEAIAAAGVSAPAIVVYRSFDEPVSEYPYPISSVTANDLGTWLEELAIPTI
GEVNGDTYSVYVASGRPLAYLFVDPNDEKSQEYIEALKPVASKYRGKLNFVWIDATKFGD
HAKALNLAEPKWPSFVIQDLRLQLKYPYDQSKEVEPAAVSTMVTDYLDGKLQPKLKSQPI
PESQDESVFVLVGEQFDEVAFDESKDVFVEFYATWCGHCKRLKPIWDSLGDHFAEVKDRV
VIAKMEAQENDLPPSVPFRIGGFPTLKFKPAGSRDFIDYDGDRSLESLIAFVEERAKNDL
TPKVKVPEDEAQATFAKPSEAHDEL
Download sequence
Identical sequences A0A0C3PVV2
jgi|Pisti1|13074|fgenesh1_pm.4_#_437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]