SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|13574|fgenesh1_pm.8_#_103 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|13574|fgenesh1_pm.8_#_103
Domain Number 1 Region: 10-201,301-392
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-54
Family FAD-linked reductases, N-terminal domain 0.0000085
Further Details:      
 
Domain Number 2 Region: 430-605
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.81e-33
Family Glutathione peroxidase-like 0.00051
Further Details:      
 
Domain Number 3 Region: 204-307
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.79e-27
Family PHBH-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|13574|fgenesh1_pm.8_#_103
Sequence length 608
Sequence
MPPQAPESYVDVLIIGAGPAGFMCGNALAAAGDIKVRIIDLRPSKVIAGQADGIQPRTIE
VLQSYGLAERLLREGNQMHMCAFYNPNVAGEIQLTSRAPDVTAPTARFPFEVTLHQGAIE
QIFMDSMAAHNLRVDRPVKPVAIEVSRDPEQLRSLSSHPVKVTLARLDAAVDADKLEVVH
AKYVVGADGAHSWVRKALGITMEGEQTDYVWGVVDMIPDSNFPDIRNKTAIHSTNGSSMI
IPREGDKVRLYVQLSESDVVDPATGRVDKNRMSSEQILEVARKTFQPFHIRPLSDVEWWT
IYIIGQRVASRYSVEDRVFIAGDACHTHSPKAGQGMNASMNDTHNLAWKVVQVLRGWASP
SILKTYEAERRKYAQDLIDFDKQFAALFSGKPRTSNNQDGVTHEDFLKAFQTFGGFTSGI
GVHYSPSMIVNTKHQNSAENLVIGERMLPQVFIRAADAKPVEIQDVLPADIRFKILVFLG
SMEESRLSEIHTFANELSSPTSFLQRYPMGRQVSLMFDIITIVAGDKQNFNYLSVPAILR
PHWSKVLLDDTDVTGSKGGGAYKRFGISTEEVTIVIVRPDGYVGMIAPAVALEDVHAYFA
SFLATHTV
Download sequence
Identical sequences A0A0C3JNW4
jgi|Pisti1|13574|fgenesh1_pm.8_#_103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]