SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|139964|e_gw1.22.825.1 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|139964|e_gw1.22.825.1
Domain Number 1 Region: 264-419
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.26e-56
Family eEF1-gamma domain 0.0000351
Further Details:      
 
Domain Number 2 Region: 81-233
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.66e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0058
Further Details:      
 
Domain Number 3 Region: 7-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000549
Family Glutathione S-transferase (GST), N-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|139964|e_gw1.22.825.1
Sequence length 427
Sequence
MAPIGKLYSVPSMNQTTIIKATAAAAGVEFEEPEYKHYEDNKKPDFLAKFPHGKIPALEC
ANGLNLTEGAAIARYIASIPPNSGLLGGTLEDAALVDQYVHFAESEIHLCTEFIYLMLNG
YMPYNKAIHTTMTERQIRGFNSLETILLTRTYLVGERLTLADITVASVIFLAVSYTLDAP
LRAKYPNILRHLDLIINQPKLKGVFGQPTFVEKAAQYTPPAKEKKEKEPKQPAPAQAPKK
EKPKKAEEDEEEEESLVPEEPKAKNPLDLLPKSTFNLEDWKRAYSNKDTRGPGGSLEWFY
ENFDREGFSVYRVDFKYNEELTLVFMSSNQIGGFFNRLEASRKYLFGSIGVLGEANNSII
AGALILRGQDVKPVVEVAPDYESYIYRKLDLENAEDKAFFEGALAWDLEIDGKKWQDGKN
VSWRFFF
Download sequence
Identical sequences A0A0C3J9Z6
jgi|Pisti1|139964|e_gw1.22.825.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]