SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|191640|CE18747_30683 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|191640|CE18747_30683
Domain Number 1 Region: 142-251
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.68e-32
Family PDI-like 0.011
Further Details:      
 
Domain Number 2 Region: 20-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.05e-30
Family PDI-like 0.0067
Further Details:      
 
Domain Number 3 Region: 264-364
Classification Level Classification E-value
Superfamily ERP29 C domain-like 5.23e-20
Family ERP29 C domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|191640|CE18747_30683
Sequence length 378
Sequence
MMRFSRPLFLSSLLAVVVASNVVDLGPDNFDAIIGKGKPGLVEFFAPWCGHCKNLAPTYE
QLGDAFSHAKDKVVIAKVDADGAGRPLGEKYGVSGYPTLKWFDEKGNAEAYEGGRDLDAL
ATFVSKKAGVKSNIKPPPPPETLILDAHTFNDVALDDTKDVLVTFTAPWCGHCKNLKPIY
EQVAQAFKPESNCIVANIDADAALNKELAAQYGVASYPTIKFFPRGGKEVEDYNGARTEE
AFVNFLNEKCGTNRAVGGGLNDQAGRLAELDALAQKFLTAAGNARDAVRKEAVALSEGLG
SASQYYARVMEKIVKDSETYIDKESKRLASILNKRTLASAKLDEIKIKLNILKAFVSQKL
EEAEEEEVNGFGRATAEL
Download sequence
Identical sequences A0A0C3PKX3
jgi|Pisti1|191640|CE18747_30683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]