SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|20257|gm1.2876_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|20257|gm1.2876_g
Domain Number 1 Region: 393-488,524-557
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000031
Family UBX domain 0.065
Further Details:      
 
Domain Number 2 Region: 191-295
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000358
Family Glutathione peroxidase-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|20257|gm1.2876_g
Sequence length 582
Sequence
MDTLAEDQRDAVRQLQAVLDSQHYDTDVLVSVLQSVDWSVHSAMELLLDGPHVDSSASSR
STMSSLDLEPQLPVDRPERAGGRGPPRTLADAIFAVLSLPFHVVTGILRFILGVFRIPFL
SLNFGASSYRPPRQPHDSRGAIRRWITTLEEETGAYNIKSSPSVATGRDSHPSTSRRHAY
PPANPETTRVLPDFFDGTYDEVLDICQKEGRIACVILVSEEHDDVPAFKRVTLTDPNLVR
IMNDNNFVVWGGDVRDKIPWDGNYFFAVLRSGSHYEVAAQKLQVTTYPFVAFLALQPRRS
TSTSSFSSSGPVLTVLSRHYGPSVPDSGPTSARSLINHLEGQLLPRVDPFLTRYRNQLQE
RERDRLLREQQDKAYRDSQRRDRERIEAKIRAEREEVERIRKEEEAQREEEKRLQAEQER
QESIKLRRSQWRRWMRRSIVPPEPRDGNSIRLAIRLPSGRVVRSFPSATTVTALYAFADS
QMIPSSMNSQDDPEHPPEGSGGGVEILERYIHSQVQGPESWWGFKLALSYPRREIKWKAN
TSLAEAGLKNGEQLVMEVTSNVVNGKKPLGHDSDDQYESESD
Download sequence
Identical sequences A0A0C3PSH6
jgi|Pisti1|20257|gm1.2876_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]