SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|21862|gm1.4481_g from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|21862|gm1.4481_g
Domain Number 1 Region: 555-669
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-24
Family Ran-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|21862|gm1.4481_g
Sequence length 677
Sequence
MKRVADNQLTKDDDGDSGDDVQEVSQGFQKADESVLATRQIRALPKRSLAGAAAKATSFN
GFGSAPTPAAAGPDKEAPTLPKFASFAGFGSSTPSSPFTFTVQPPPTAPTPPTAPSSAAG
FNFHSTLKPPQSSTSSDSPNGTLPTQSTHSTGGVNGDATVLKYYKSLRGLNVSFLSAISK
AIEQDPFADVTGLLESYKNLRMTVQSEFDNSSKHSTTSSSTPGPSAITTETPAPVSQFAM
PKPPSAFPGLPATASTSTSDNRFSVTPAVKASPFSFSLPTTSSSTAPSFGPSPKANDPSA
QPSSSASEPPKSAFTFGTSKADDSNTSKPSFFAFGTTGSLSSKQNPFDSSTNPSEISPFS
AFKSSPDAPKFFATSKVPSTTSDIGAKTTTTFGTSTSIFGSNVDGGKPPLCTPSTGCDIT
ETGDKVDASKEPPKTFATSLFGGSFSGNPSSSPTAGAFSSEQPISVFGASPQKPSVFGFG
KPAGSIGNPVGFGFGALAPKAGDSGGPTNSLRRSPAVSPPPTEKSGESTPQPEANEETPP
AEDDPAKSLTTATHDEEGEGEEDEETVHVVKCKIFKLTKTDDKNEWKDLGIGMLRLKKHK
ENNTRRVLMRNSHTGRILLNFRLFSGLKPSLAKTSVAFVGHENGAPASYRIRVKTESQAV
SLKDAMDREIAASQATS
Download sequence
Identical sequences A0A0C3KKR9
jgi|Pisti1|21862|gm1.4481_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]