SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|364936|CE192043_7981 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|364936|CE192043_7981
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.05e-33
Family Thioltransferase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|364936|CE192043_7981
Sequence length 156
Sequence
MAITHLTSVSQLNTILSESNDKLTVIDFHATWCGPCHAIAPIFEALAKQYPSVNFLKCDV
DAAKDVASTYRVSAMPTFVFLKGGKQVHTIKGADKQGLQNALKQLTGPTAGTFPGQGQTL
GGSPSGGDQGSTWTNMDPQLKILLALVAAYIFFWLM
Download sequence
Identical sequences A0A0C3PK40
jgi|Pisti1|364936|CE192043_7981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]