SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|376473|CE203580_6226 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|376473|CE203580_6226
Domain Number 1 Region: 2-78,175-270
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-34
Family FAD-linked reductases, N-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 415-499
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000047
Family Glutathione peroxidase-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|376473|CE203580_6226
Sequence length 505
Sequence
MGQHVLEAILREHLAKLGCTVELGTRLVSFTQDEKCVRVKIAKHRGDDGEEVEEDIEVAY
LIGADGAKSVTRKQLGLTFLGTTREDDFLVGGDIRLEVKGLDRDHWHWFGTVSQDVITLR
PTNELGKDGWQVGISSGTTDLKGLARDEEALVSCIKDFIGLGDDVKVKEVMWVSEFRPNI
RLVNKFGVGRIFICGDAAHAHSPAGGQGLNSSVQDALNIAWKIALVYKGLSPASLLDTYT
IERLPVITEMLGFTTELHNRTFDHSSVERTPRSTSGETASSKQVKPNLEHSMRRGEKMYM
LGVNYRNSPIVIDEFAPTPTSGAEVTYSAYGDTQEGVLLAGDRAPDAPGLVPVISPNRAS
CSISSGSQSNGMAGSTRMFDIFALTHHTVIIFAPALADTQVRSVLVMLDQSVRKEFVRRV
IILPGPPSELDGRVEMPSGDDQAIDAEVLVDQAGHAHQGYVVEKQEIKVVVVRPDGVVGA
IVRGVTGLEQYFEGVFGKTECMRTR
Download sequence
Identical sequences A0A0C3PHI0
jgi|Pisti1|376473|CE203580_6226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]