SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|7446|fgenesh1_pg.8_#_85 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|7446|fgenesh1_pg.8_#_85
Domain Number 1 Region: 9-178
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-17
Family FAD-linked reductases, N-terminal domain 0.0095
Further Details:      
 
Domain Number 2 Region: 181-274
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000403
Family Glutathione peroxidase-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|7446|fgenesh1_pg.8_#_85
Sequence length 276
Sequence
MTVHSAPSKVDVLIIGAGPAGVMWANTLVPRRCKRSHRGPTSYGLGDRLLRKDCRVYMAT
FYEPSENGGIKLSRRAPDITAPSARYPFELALRQRAIESIFLDSMKTRGAEVQRSTRPIE
IELSNDAAELADPTSYPVKVTLGRLSPNGTVHHEVVHAKFVLCADGAHSWVRNAFGIAMD
LVLTGDFNAPIQTQKIQALEKSLEQPESFLNQYPRERVLLDDTDVSGTIGGKGYAYYGIP
DEGALVVVRPDGYIVMITPLDGSGEINKYFARFMNA
Download sequence
Identical sequences A0A0C3KMP5
jgi|Pisti1|7446|fgenesh1_pg.8_#_85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]