SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|851623|CE678730_47335 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|851623|CE678730_47335
Domain Number 1 Region: 182-283
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.91e-30
Family PDI-like 0.0069
Further Details:      
 
Domain Number 2 Region: 35-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.32e-23
Family PDI-like 0.0063
Further Details:      
 
Weak hits

Sequence:  jgi|Pisti1|851623|CE678730_47335
Domain Number - Region: 400-502
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00927
Family Thioltransferase 0.045
Further Details:      
 
Domain Number - Region: 293-403
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0106
Family Thioltransferase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|851623|CE678730_47335
Sequence length 598
Sequence
MRALLSLTRRRSPLSFLVAALAIQATAAPVTASNVLTPDNFEETIASGVWFIEYFSPYCP
HCRHFAPTWTEVTDHFEKQTDPGVHLAQVNCALNGDLCSEKGVTGYPQMNLYHNGEFVDT
FTKNRQFDLLVDYLGEHAVPTGVAVSDSTVEEKVFATVSPPEPTPVFDEPLRVQAPRVDP
NPAGEVVKLTTETFDSFLSQGPAFVKFFAPWCGHCKKLAPTWSQLARHMQHKLNVAEVNC
DDQKPLCSSQSIPGYPTLLYYAHGAKTEYTGNRKYDQLVAFSEHASNPTMQAIEASQLEE
VIRDKPVIYLLLHTPADKSVMDRVAKESQLLFGSPPVYLSSSQELFKRYNIRGDAPYAIL
ALKDHDARQPTSTFYPSLSHPERDALREWFFANRFPTSLELSRDVFQDVMNAPHQPLVVI
VSTPPGARDSVTEKLNDIGKKWRLKMNQGQHGGRRRDVVFTWMDTDQWGKWMKNMYGIKA
AGEPEVVVADHQRLLYYNKDGSGQLIKLNFVSISSALEPILQGKARPKHSQNIFERVVQV
LNSSVVRLGQSIATHPYVTVLFVLGFLASVFMAITKLLRDDFEDSHPDKRYAKSGRID
Download sequence
Identical sequences A0A0C3JLM6
jgi|Pisti1|851623|CE678730_47335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]