SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|865513|CE692620_1057 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|865513|CE692620_1057
Domain Number 1 Region: 10-200,300-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.1e-56
Family FAD-linked reductases, N-terminal domain 0.0000125
Further Details:      
 
Domain Number 2 Region: 430-607
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.37e-33
Family Glutathione peroxidase-like 0.00096
Further Details:      
 
Domain Number 3 Region: 203-306
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.92e-26
Family PHBH-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|865513|CE692620_1057
Sequence length 613
Sequence
MRLQTRESFVDVLIVGAGPAGLMCGNALAAAGDIKVRIIDRRPSKISVGHADGIQPRTIE
VLQSYGLAERLLREGCQMHMFAFYNPNQSGGIEFTARASDAVPTARFPFKIGLHQGAIED
AFIDSMAQHNLRVDRPVEPLAIELSRDQEQLRSLSSYPVKVTLAHLNATIDADKLEVVRA
KYVVGADGAHSWVRNAFGISMDGDQTDSLWGVVDMVPDTNFPDIRHVAVIHSTNGSILSV
PRENDKVRLYVQLSEKDIVDPETGRVSKTKSSPEKILEVARKTLHPFYISPLSGIEWWTI
YLIGQRVASRFSVEDRVFIAGDACHTHSPKAGQGMNASMSDTHNLAWKLVQVLRGWASPS
ILKTYESERRKYAIDLIDFDKQYAAMFSGKPRTSDNEDGVSPEEVLQAIETASGFACGTS
IHYGPSVIVNTKHQYCAENLVVGQRMLPQVFVHAADARPVDIHDLLPADIRFKILIFLGS
MEEESRVVEINALADELSSPAGLLQKYSMGGRTSSPIFDLITIVAGKKEKFNYLRVPLVF
RPHWSKVLLDDTDVTGRMGGGAYERFGISSKSVTFVIVRPDGYVGMVAPAAAMGDVHKYF
ASFLLPRHWVSRL
Download sequence
Identical sequences A0A0C3NRU3
jgi|Pisti1|865513|CE692620_1057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]