SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|878217|CE705324_22034 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|878217|CE705324_22034
Domain Number 1 Region: 218-332
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-22
Family Ran-binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|878217|CE705324_22034
Sequence length 335
Sequence
MAYASAASPFASVKGQNVFFSASSNKNQPTSPIRASTSLPGSSNLTKSSLPQTPLASLAQ
QTYLQQTPTSTATKRTGFEAFAGSASPFSPSFGHSRPMSPGTANSRSAFVRSKSPVRRGT
FSANSGAFSSYASGGTQGFVVPHPKRARAGSPSNGSSRSSLERKESIFFSAPGSNENSTS
GEEEEGEKEESEFAPSSFGERLRSAKDADDSQSDREKEKLTEQEVLTGEEEEETIHQVRG
KLYVLCPQNQWKERGTGQLKLNVRRTDGGGARLAVYTVILNVTLFPGMKCFIAQDPRYLR
FSAIDGGTTVHYNLRVSNAKIAQELLEEIDANLPS
Download sequence
Identical sequences A0A0C3PQP4
jgi|Pisti1|878217|CE705324_22034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]