SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|950015|MIX21866_743_100 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|950015|MIX21866_743_100
Domain Number 1 Region: 53-193
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.91e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 11-62
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000013
Family Glutathione S-transferase (GST), N-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|950015|MIX21866_743_100
Sequence length 196
Sequence
DDLPPFELGVTNKLPEFTHKFPLAKIPAFEDNEGFKLIEGATIARYVSSLVPQAGLLGRN
AKETAQIDQWIHFAETEIQIPGTNIYIGMVSKYLPGFGEEECKYYRGFIGRSLKFLEDYL
TSRPSGLLVGDTLTLADIVVATAVMRAGQTVCGTKERKDVYPHVFAHFAKVANDERIKHF
FKDLKFVDEPLAFKVA
Download sequence
Identical sequences A0A0C3J5N2
jgi|Pisti1|950015|MIX21866_743_100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]