SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pisti1|997617|fgenesh1_kg.15_#_39_#_Locus7689v1rpkm18.53 from Pisolithus tinctorius Marx 270 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pisti1|997617|fgenesh1_kg.15_#_39_#_Locus7689v1rpkm18.53
Domain Number 1 Region: 6-186,283-369
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.45e-53
Family FAD-linked reductases, N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 484-598
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000895
Family Glutathione peroxidase-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pisti1|997617|fgenesh1_kg.15_#_39_#_Locus7689v1rpkm18.53
Sequence length 603
Sequence
MTTCTTPVLVVGAGPAGLVAALTLARNNVPVRIIEKEPQYRRGQRGAGIQPRTFEAFHFL
HVPEVHERAAFFPLLQEHDKGSLESLNTFPMTPYMEPTPAIPYYNCKAMGQHVLEAIMRE
HLAKLGCTIELGTQLVSFTQDEKCVRVKVAKRRGDDEEEVEEDIEVAYLIGADGAKGVTR
KQLGLTFLGTTREDDLIVLGDIRLEAKGLDRDHWHFFGTMSQAMITLRPTDELGRDGWQF
VMSSRKTDLRGLVRDEEAVVNCIKDFLGLGDDVQVKEVICVSEFRPNIRLVNKFGVGRIF
VCGDAAHVHSPAGGQGLNSSVQDALNVAWKIALVYKGLSPASLLDTYTTERLPVITEMLG
FTTELHDRTFDQSNGENDSSKQVKFNLEDAMRRGGKLYMLGVNYRNSPIVVDEFAPTPAS
GAEGTHSAYGDTQEGVLRAGDRAPDAPGLVPTSLNRASCSISSGSQSNGMAVSTRMFDIF
ASTHHTVIIFAPAFADAEVRSVLLTLDQSLRKKLVRRVVVLPGPFPEADRPVDMSSGEGQ
AIDADILVDQAGHAYRGYVVEKQEIKVVVVRPDGVVGAIVRGVTGLEQYFEGVFGKTEGM
RAK
Download sequence
Identical sequences A0A0C3JFR5
jgi|Pisti1|997617|fgenesh1_kg.15_#_39_#_Locus7689v1rpkm18.53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]