SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|110177|e_gw1.313.52.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|110177|e_gw1.313.52.1
Domain Number 1 Region: 42-140
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-23
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|110177|e_gw1.313.52.1
Sequence length 141
Sequence
MHISLRQHELKLWCTIDVSLLFRTFFSECLLVNCRSASVNNSGLRLAGGSENRGRLEVYH
NGEWRTVCDDAFSNADAAVFCRSMGTPYENAEAIASFGGGSGPIHMDEVNCDGQQFAMFC
LNRGWGVNDCGHFEHVGSNCL
Download sequence
Identical sequences R7UJK1
jgi|Capca1|110177|e_gw1.313.52.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]