SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|113791|e_gw1.316.44.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|113791|e_gw1.316.44.1
Domain Number 1 Region: 17-124
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 129-237
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|113791|e_gw1.316.44.1
Sequence length 249
Sequence
MTLNSKLFLSQAVAAQDVKVRLGNGLNDREGRVEILYDGTWGTICDDGWDVQDAAVICAM
VGFSGLARAFTQASPFGPGSGPIHLSQVECDGNEQSISFCSHAGWDNNRCTHAEDAGVSC
LGVRVSNNPSTDIRLVDGPNDAAGRVQVRDKNRWYAVCDDFWDLNDAAVVCRMLCYNPIN
ARAHIGGAYGNTTEEFLLDDVMCSGDETDLMDCPNAGLSNSDCDYAEGAGVSCLQDTPTP
PPCGYKCQA
Download sequence
Identical sequences R7UCU1
jgi|Capca1|113791|e_gw1.316.44.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]