SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|131869|e_gw1.52.83.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Capca1|131869|e_gw1.52.83.1
Domain Number - Region: 21-149
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00353
Family Pentapeptide repeats 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|131869|e_gw1.52.83.1
Sequence length 193
Sequence
SLIIYVIFTFSKFEHSLIFFTIFTFTKFKHSFVFIAFLSFSKLEHSLLFLAIFTFSKLEH
SLLFLAIFTFSKLEHSLLFLAIFTLPKLEHSLLLLAIFTFSKFEHSLLFLAIFTLPKLEH
SLFFLAIFTLSKLEHSLLFLAIFTLSKLEHSLLIFVIHQCIWYAVYRALFPLCWICHLFL
DVDDVIDAVSLPK
Download sequence
Identical sequences R7TRI8
jgi|Capca1|131869|e_gw1.52.83.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]