SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|142796|e_gw1.429.17.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|142796|e_gw1.429.17.1
Domain Number 1 Region: 22-126
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00073
Further Details:      
 
Domain Number 2 Region: 165-274
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|142796|e_gw1.429.17.1
Sequence length 481
Sequence
MIIAVGLIVLLASAHGDVPADGSLRLTGGAMETTGNVMVFYQGKWGIVCDDGWSLRAADV
VCRSLGYLRALGHTDQAYFGTPNEDVFLDNVRCRGDESSLLECDRNPWHDHDCEKSEAAG
VFCAPLPGSLSSPLRVNVSNSTPRITSPHEQHTPTQGPETNSIRMPIRLRGGRNEDEGRV
EVRVQGHWGAICGDHWTLLEATVVCKQVGKGHARSAVMSSVFGGEHLAKVLSGIDCMGEE
DSLDECSHARRSHDIACPEQDFIAGVVCTHELPDLVPNATLLESSTYLQDKQMYYLTCAM
EENCASASAYEIKKTVRDWHIHQRRLMRFSSSTWNFGTADFRPESNKADWEWHLCHMHFH
SMEVFAHYDLLDLQHNKVAEGHKASFCLEDVQCLPGKQKKFACKGYGDQGISVGCADDYL
HDIDCQWIDITDLKPGTYIFRVHINPNNHVAELSYSNNAVHCDLSYTGLSVTVTNCENGP
I
Download sequence
Identical sequences R7TZG4
jgi|Capca1|142796|e_gw1.429.17.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]