SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|147461|e_gw1.7846.1.1 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|147461|e_gw1.7846.1.1
Domain Number 1 Region: 5-269
Classification Level Classification E-value
Superfamily Outer membrane phospholipase A (OMPLA) 3.53e-97
Family Outer membrane phospholipase A (OMPLA) 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|147461|e_gw1.7846.1.1
Sequence length 269
Sequence
SIVEQRVQEEEETLDNRFAITPHRPNYLLPISYNKSPNETPFEVQNIDNFSSTEIKFQLS
VKAPLAQGVFNGYGDLYVAYTNTSWWQAYNSNSAPFRETNHEPEVFIVFPTDYQLWGFDL
NGVAAGLTHQSNGRSGELSRSWNRLYAQFIFSRDNFAISIKPWWRIPEPEKEPGQENSSK
GDDNPDIEKYMGYGELHLGYQVQEHNLGMTLRNNLRSDNKGAVQLDWSFPINKRFRGYIQ
YFNGYGESLIDYNDSANRLSVGVMLTDWL
Download sequence
Identical sequences R7T9G0
jgi|Capca1|147461|e_gw1.7846.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]